PPIL1 (NM_016059) Human Mass Spec Standard

CAT#: PH300015

PPIL1 MS Standard C13 and N15-labeled recombinant protein (NP_057143)

Product Images

Coomassie blue staining of purified PPIL1 protein (Cat# TP300015). The protein was produced from HEK293T cells transfected with PPIL1 cDNA clone (Cat# RC200015) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200015
• Predicted MW: 18.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200015 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT
  GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVN
  RVGMVETNSQDRPVDDVKIIKAYPSG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057143
• RefSeq Size: 1750
• RefSeq ORF: 498
• Synonyms: CGI-124; CYPL1; hCyPX; PPIase
• Locus ID: 51645
• UniProt ID: Q9Y3C6, A0A024RCX8
• Cytogenetics: 6p21.2
• Summary: This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq, Jul 2008]
• Protein Pathways: Spliceosome