PPIL1 (NM_016059) Human Recombinant Protein
CAT#: TP300015
Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200015 protein sequence
Red=Cloning site Green=Tags(s) MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVN RVGMVETNSQDRPVDDVKIIKAYPSG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057143 |
Locus ID | 51645 |
UniProt ID | Q9Y3C6, A0A024RCX8, A0A494C014 |
Cytogenetics | 6p21.2 |
Refseq Size | 1750 |
Refseq ORF | 498 |
Synonyms | CGI-124; CYPL1; hCyPX; PCH14; PPIase |
Summary | This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq, Jul 2008] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414224 | PPIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY414224 | Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) |
USD 325.00 |
|
PH300015 | PPIL1 MS Standard C13 and N15-labeled recombinant protein (NP_057143) |
USD 2,055.00 |
|
TP720261 | Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review