NDUFAF1 (NM_016013) Human Mass Spec Standard

CAT#: PH300029

NDUFAF1 MS Standard C13 and N15-labeled recombinant protein (NP_057097)

Product Images

Coomassie blue staining of purified NDUFAF1 protein (Cat# TP300029). The protein was produced from HEK293T cells transfected with NDUFAF1 cDNA clone (Cat# RC200029) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200029
• Predicted MW: 37.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200029 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALD
  ITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQAKVVWQFRGKEDLDKWTVTS
  DKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRSGYCAMISRIPRGAFERKMSYDWSQFNTLYL
  RVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKIS
  SIGFTLADKVDGPFFLEIDFIGVFTDPAHTEEFAYENSPELNPRLFK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057097
• RefSeq Size: 1488
• RefSeq ORF: 981
• Synonyms: CGI-65; CGI65; CIA30; MC1DN11
• Locus ID: 51103
• UniProt ID: Q9Y375, A0A024R9L0
• Cytogenetics: 15q15.1
• Summary: This gene encodes a complex I assembly factor protein. Complex I (NADH-ubiquinone oxidoreductase) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. The encoded protein is required for assembly of complex I, and mutations in this gene are a cause of mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 19. [provided by RefSeq, Dec 2011]