Glutathione S Transferase theta 2 (GSTT2) (NM_000854) Human Mass Spec Standard

CAT#: PH300040

GSTT2 MS Standard C13 and N15-labeled recombinant protein (NP_000845)

Product Images

Coomassie blue staining of purified GSTT2 protein (Cat# TP300040). The protein was produced from HEK293T cells transfected with GSTT2 cDNA clone (Cat# RC200040) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200040
• Predicted MW: 27.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200040 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAI
  LIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMD
  QALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAH
  SIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000845
• RefSeq Size: 1136
• RefSeq ORF: 732
• Locus ID: 2953
• UniProt ID: P0CG29
• Cytogenetics: 22q11.23
• Summary: 'The protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT2 and GSTT2B are nearly identical to each other, and share 55% amino acid identity with GSTT1. All three genes may play a role in human carcinogenesis. The GSTT2 gene is a pseudogene in some populations. [provided by RefSeq, Sep 2015]'
• Protein Pathways: Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450