IMPA2 (NM_014214) Human Mass Spec Standard

CAT#: PH300063

IMPA2 MS Standard C13 and N15-labeled recombinant protein (NP_055029)

Product Images

Coomassie blue staining of purified IMPA2 protein (Cat# TP300063). The protein was produced from HEK293T cells transfected with IMPA2 cDNA clone (Cat# RC200063) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200063
• Predicted MW: 31.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200063 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELR
  ERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEER
  LYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLA
  LCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTI
  NYGRDDEK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055029
• RefSeq Size: 1537
• RefSeq ORF: 864
• Synonyms: inosine monophosphatase 2; inositol(myo)-1(or 4)-monophosphatase 2; inositol monophosphatase 2 variant 1; inositol monophosphatase 2 variant 2
• Locus ID: 3613
• UniProt ID: O14732
• Cytogenetics: 18p11.21
• Summary: 'This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. [provided by RefSeq, Jan 2011]'
• Protein Pathways: Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system