IMPA2 (NM_014214) Human Mass Spec Standard
CAT#: PH300063
IMPA2 MS Standard C13 and N15-labeled recombinant protein (NP_055029)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200063 |
Predicted MW | 31.3 kDa |
Protein Sequence |
>RC200063 protein sequence
Red=Cloning site Green=Tags(s) MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELR ERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEER LYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLA LCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTI NYGRDDEK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055029 |
RefSeq Size | 1537 |
RefSeq ORF | 864 |
Synonyms | inosine monophosphatase 2; inositol(myo)-1(or 4)-monophosphatase 2; inositol monophosphatase 2 variant 1; inositol monophosphatase 2 variant 2 |
Locus ID | 3613 |
UniProt ID | O14732 |
Cytogenetics | 18p11.21 |
Summary | 'This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. [provided by RefSeq, Jan 2011]' |
Protein Pathways | Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415429 | IMPA2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY415429 | Transient overexpression lysate of inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2) |
USD 325.00 |
|
TP300063 | Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2) |
USD 823.00 |
|
TP720526 | Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review