COX16 (NM_016468) Human Mass Spec Standard

CAT#: PH300099

COX16 MS Standard C13 and N15-labeled recombinant protein (NP_057552)

Product Images

Coomassie blue staining of purified COX16 protein (Cat# TP300099). The protein was produced from HEK293T cells transfected with COX16 cDNA clone (Cat# RC200099) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200099
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200099 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKI
  KDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057552
• RefSeq Size: 1724
• RefSeq ORF: 318
• Synonyms: C14orf112; hCOX16; HSPC203
• Locus ID: 51241
• UniProt ID: Q9P0S2
• Cytogenetics: 14q24.2
• Protein Families: Secreted Protein, Transmembrane