COX16 (NM_016468) Human Mass Spec Standard
CAT#: PH300099
COX16 MS Standard C13 and N15-labeled recombinant protein (NP_057552)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200099 |
Predicted MW | 12.3 kDa |
Protein Sequence |
>RC200099 protein sequence
Red=Cloning site Green=Tags(s) MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKI KDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057552 |
RefSeq Size | 1724 |
RefSeq ORF | 318 |
Synonyms | C14orf112; hCOX16; HSPC203 |
Locus ID | 51241 |
UniProt ID | Q9P0S2 |
Cytogenetics | 14q24.2 |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413968 | COX16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413968 | Transient overexpression lysate of COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16) |
USD 396.00 |
|
TP300099 | Recombinant protein of human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review