COX16 (NM_016468) Human Recombinant Protein
CAT#: TP300099
Recombinant protein of human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16)
View other "COX16" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200099 protein sequence
Red=Cloning site Green=Tags(s) MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKI KDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057552 |
Locus ID | 51241 |
UniProt ID | Q9P0S2 |
Cytogenetics | 14q24.2 |
Refseq Size | 1724 |
Refseq ORF | 318 |
Synonyms | C14orf112; hCOX16; HSPC203 |
Summary | Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase (PubMed:29355485, PubMed:29381136). Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2) (PubMed:29355485, PubMed:29381136). Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6 (PubMed:29381136). Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines (PubMed:29381136).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413968 | COX16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413968 | Transient overexpression lysate of COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16) |
USD 396.00 |
|
PH300099 | COX16 MS Standard C13 and N15-labeled recombinant protein (NP_057552) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review