Ceramide synthase 2 (CERS2) (NM_022075) Human Mass Spec Standard

CAT#: PH300145

LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_071358)

Product Images

Coomassie blue staining of purified CERS2 protein (Cat# TP300145). The protein was produced from HEK293T cells transfected with CERS2 cDNA clone (Cat# RC200145) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200145
• Predicted MW: 44.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200145 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI
  KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF
  TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI
  IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL
  PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE
  GEEAAAGGGAKSRPLANGHPILNNNHRKND
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071358
• RefSeq Size: 2504
• RefSeq ORF: 1140
• Synonyms: L3; LASS2; SP260; TMSG1
• Locus ID: 29956
• UniProt ID: Q96G23
• Cytogenetics: 1q21.3
• Summary: This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors, Transmembrane