Ceramide synthase 2 (CERS2) (NM_022075) Human Mass Spec Standard
CAT#: PH300145
LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_071358)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200145 |
| Predicted MW | 44.9 kDa |
| Protein Sequence |
>RC200145 protein sequence
Red=Cloning site Green=Tags(s) MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE GEEAAAGGGAKSRPLANGHPILNNNHRKND myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_071358 |
| RefSeq Size | 2504 |
| RefSeq ORF | 1140 |
| Synonyms | L3; LASS2; SP260; TMSG1 |
| Locus ID | 29956 |
| UniProt ID | Q96G23 |
| Cytogenetics | 1q21.3 |
| Summary | This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405622 | CERS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC411798 | CERS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429671 | CERS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY405622 | Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1 |
USD 436.00 |
|
| LY411798 | Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2 |
USD 436.00 |
|
| LY429671 | Transient overexpression lysate of LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2 |
USD 396.00 |
|
| PH315300 | LASS2 MS Standard C13 and N15-labeled recombinant protein (NP_859530) |
USD 2,055.00 |
|
| TP300145 | Purified recombinant protein of Homo sapiens LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 2 |
USD 823.00 |
|
| TP315300 | Recombinant protein of human LAG1 homolog, ceramide synthase 2 (LASS2), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China