DUSP23 (NM_017823) Human Mass Spec Standard
CAT#: PH300171
DUSP23 MS Standard C13 and N15-labeled recombinant protein (NP_060293)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200171 |
Predicted MW | 16.6 kDa |
Protein Sequence |
>RC200171 protein sequence
Red=Cloning site Green=Tags(s) MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPA PDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK AVFQFYQRTK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060293 |
RefSeq Size | 718 |
RefSeq ORF | 450 |
Synonyms | DUSP25; LDP-3; LDP3; MOSP; VHZ |
Locus ID | 54935 |
UniProt ID | Q9BVJ7, A0A140VJI5 |
Cytogenetics | 1q23.2 |
Summary | Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14). [UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402621 | DUSP23 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402621 | Transient overexpression lysate of dual specificity phosphatase 23 (DUSP23) |
USD 396.00 |
|
TP300171 | Recombinant protein of human dual specificity phosphatase 23 (DUSP23) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review