DUSP23 (NM_017823) Human Mass Spec Standard

CAT#: PH300171

DUSP23 MS Standard C13 and N15-labeled recombinant protein (NP_060293)

Product Images

Coomassie blue staining of purified DUSP23 protein (Cat# TP300171). The protein was produced from HEK293T cells transfected with DUSP23 cDNA clone (Cat# RC200171) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200171
• Predicted MW: 16.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200171 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPA
  PDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK
  AVFQFYQRTK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060293
• RefSeq Size: 718
• RefSeq ORF: 450
• Synonyms: DUSP25; LDP-3; LDP3; MOSP; VHZ
• Locus ID: 54935
• UniProt ID: Q9BVJ7, A0A140VJI5
• Cytogenetics: 1q23.2
• Summary: Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14). [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Phosphatase