CHCHD3 (NM_017812) Human Mass Spec Standard

CAT#: PH300174

CHCHD3 MS Standard C13 and N15-labeled recombinant protein (NP_060282)

Product Images

Coomassie blue staining of purified CHCHD3 protein (Cat# TP300174). The protein was produced from HEK293T cells transfected with CHCHD3 cDNA clone (Cat# RC200174) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200174
• Predicted MW: 26.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200174 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGTTSTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEEL
  ALEQAKKESEDQKRLKQAKELDRERAAANEQLTRAILRERICSEEERAKAKHLARQLEEKDRVLKKQDAF
  YKEQLARLEERSSEFYRVTTEQYQKAAEEVEAKFKRYESHPVCADLQAKILQCYRENTHQTLKCSALATQ
  YMHCVNHAKQSMLEKGG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060282
• RefSeq Size: 1622
• RefSeq ORF: 681
• Synonyms: Mic19; MICOS19; MINOS3; PPP1R22
• Locus ID: 54927
• UniProt ID: Q9NX63, A4D1N4
• Cytogenetics: 7q32.3-q33
• Summary: The protein encoded by this gene is an inner mitochondrial membrane scaffold protein. Absence of the encoded protein affects the structural integrity of mitochondrial cristae and leads to reductions in ATP production, cell growth, and oxygen consumption. This protein is part of the mitochondrial contact site and cristae organizing system (MICOS). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]