KCTD5 (NM_018992) Human Mass Spec Standard

CAT#: PH300180

KCTD5 MS Standard C13 and N15-labeled recombinant protein (NP_061865)

Product Images

Coomassie blue staining of purified KCTD5 protein (Cat# TP300180). The protein was produced from HEK293T cells transfected with KCTD5 cDNA clone (Cat# RC200180) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200180
• Predicted MW: 26.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200180 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFL
  YRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKD
  KIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELH
  NTPYGTASEPSEKAKILQERGSRM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061865
• RefSeq Size: 2479
• RefSeq ORF: 702
• Synonyms: FLJ20040
• Locus ID: 54442
• UniProt ID: Q9NXV2
• Cytogenetics: 16p13.3
• Summary: Its interaction with CUL3 suggests that it may act as a substrate adapter in some E3 ligase complex. Does not affect the function of Kv channel Kv2.1/KCNB1, Kv1.2/KCNA2, Kv4.2/KCND2 and Kv3.4/KCNC4. [UniProtKB/Swiss-Prot Function]
• Protein Families: Ion Channels: Other