NUDT5 (NM_014142) Human Mass Spec Standard
CAT#: PH300204
NUDT5 MS Standard C13 and N15-labeled recombinant protein (NP_054861)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200204 |
Predicted MW | 24.3 kDa |
Protein Sequence |
>RC200204 protein sequence
Red=Cloning site Green=Tags(s) MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQR TLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCT IHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAK PFEVPFLKF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_054861 |
RefSeq Size | 1224 |
RefSeq ORF | 657 |
Synonyms | hNUDT5; YSA1; YSA1H; YSAH1 |
Locus ID | 11164 |
UniProt ID | Q9UKK9 |
Cytogenetics | 10p14 |
Summary | This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors. [provided by RefSeq, Aug 2013] |
Protein Pathways | Purine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415472 | NUDT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415472 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5) |
USD 396.00 |
|
TP300204 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review