AKR1C3 (NM_003739) Human Mass Spec Standard
CAT#: PH300210
AKR1C3 MS Standard C13 and N15-labeled recombinant protein (NP_003730)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200210 |
Predicted MW | 36.9 kDa |
Protein Sequence |
>RC200210 protein sequence
Red=Cloning site Green=Tags(s) MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA DGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFD IVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKD IVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN VQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003730 |
RefSeq Size | 1251 |
RefSeq ORF | 969 |
Synonyms | DD3; DDX; HA1753; HAKRB; HAKRe; hluPGFS; HSD17B5; PGFS |
Locus ID | 8644 |
UniProt ID | P42330 |
Cytogenetics | 10p15.1 |
Summary | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Arachidonic acid metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418464 | AKR1C3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418464 | Transient overexpression lysate of aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) (AKR1C3) |
USD 325.00 |
|
TP300210 | Recombinant protein of human aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) (AKR1C3) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review