Malignant T cell amplified sequence 1 (MCTS1) (NM_014060) Human Mass Spec Standard
CAT#: PH300224
MCTS1 MS Standard C13 and N15-labeled recombinant protein (NP_054779)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200224 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC200224 protein sequence
Red=Cloning site Green=Tags(s) MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLF FRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQ HALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_054779 |
RefSeq Size | 9805 |
RefSeq ORF | 543 |
Synonyms | MCT-1; MCT1 |
Locus ID | 28985 |
UniProt ID | Q9ULC4 |
Cytogenetics | Xq24 |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415503 | MCTS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415503 | Transient overexpression lysate of malignant T cell amplified sequence 1 (MCTS1), transcript variant 1 |
USD 396.00 |
|
TP300224 | Recombinant protein of human malignant T cell amplified sequence 1 (MCTS1), transcript variant 1 |
USD 823.00 |
|
TP761506 | Purified recombinant protein of Human malignant T cell amplified sequence 1 (MCTS1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review