TOLLIP (NM_019009) Human Mass Spec Standard
CAT#: PH300227
TOLLIP MS Standard C13 and N15-labeled recombinant protein (NP_061882)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200227 |
Predicted MW | 30.3 kDa |
Protein Sequence |
>RC200227 protein sequence
Red=Cloning site Green=Tags(s) MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGM TRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPE SLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCS PGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061882 |
RefSeq Size | 3665 |
RefSeq ORF | 822 |
Synonyms | IL-1RAcPIP |
Locus ID | 54472 |
UniProt ID | Q9H0E2, Q6FIE9 |
Cytogenetics | 11p15.5 |
Summary | This gene encodes a ubiquitin-binding protein that interacts with several Toll-like receptor (TLR) signaling cascade components. The encoded protein regulates inflammatory signaling and is involved in interleukin-1 receptor trafficking and in the turnover of IL1R-associated kinase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Toll-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402724 | TOLLIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402724 | Transient overexpression lysate of toll interacting protein (TOLLIP) |
USD 325.00 |
|
TP300227 | Recombinant protein of human toll interacting protein (TOLLIP) |
USD 823.00 |
|
TP720557 | Recombinant protein of human toll interacting protein (TOLLIP) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review