TOLLIP (NM_019009) Human Mass Spec Standard

CAT#: PH300227

TOLLIP MS Standard C13 and N15-labeled recombinant protein (NP_061882)

Product Images

Coomassie blue staining of purified TOLLIP protein (Cat# TP300227). The protein was produced from HEK293T cells transfected with TOLLIP cDNA clone (Cat# RC200227) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200227
• Predicted MW: 30.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200227 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGM
  TRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPE
  SLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCS
  PGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061882
• RefSeq Size: 3665
• RefSeq ORF: 822
• Synonyms: IL-1RAcPIP
• Locus ID: 54472
• UniProt ID: Q9H0E2, Q6FIE9
• Cytogenetics: 11p15.5
• Summary: This gene encodes a ubiquitin-binding protein that interacts with several Toll-like receptor (TLR) signaling cascade components. The encoded protein regulates inflammatory signaling and is involved in interleukin-1 receptor trafficking and in the turnover of IL1R-associated kinase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]
• Protein Families: Druggable Genome
• Protein Pathways: Toll-like receptor signaling pathway