PDCD10 (NM_007217) Human Mass Spec Standard

CAT#: PH300235

PDCD10 MS Standard C13 and N15-labeled recombinant protein (NP_009148)

Product Images

Coomassie blue staining of purified PDCD10 protein (Cat# TP300235). The protein was produced from HEK293T cells transfected with PDCD10 cDNA clone (Cat# RC200235) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200235
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200235 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK
  SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKE
  LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT
  VA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009148
• RefSeq Size: 1454
• RefSeq ORF: 636
• Synonyms: CCM3; TFAR15
• Locus ID: 11235
• UniProt ID: Q9BUL8
• Cytogenetics: 3q26.1
• Summary: This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome