14-3-3 epsilon (YWHAE) (NM_006761) Human Mass Spec Standard
CAT#: PH300245
YWHAE MS Standard C13 and N15-labeled recombinant protein (NP_006752)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200245 |
Predicted MW | 29.2 kDa |
Protein Sequence |
>RC200245 protein sequence
Red=Cloning site Green=Tags(s) MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE ENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGND RKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLS EESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006752 |
RefSeq Size | 1827 |
RefSeq ORF | 765 |
Synonyms | 14-3-3E; HEL2; KCIP-1; MDCR; MDS |
Locus ID | 7531 |
UniProt ID | P62258, V9HW98 |
Cytogenetics | 17p13.3 |
Summary | 'This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene. [provided by RefSeq, Aug 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402021 | YWHAE HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402021 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), transcript variant 1 |
USD 325.00 |
|
TP300245 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), transcript variant 1 |
USD 823.00 |
|
TP720511 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), transcript variant 1 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review