RAB31 (NM_006868) Human Mass Spec Standard

CAT#: PH300249

RAB31 MS Standard C13 and N15-labeled recombinant protein (NP_006859)

Product Images

Coomassie blue staining of purified RAB31 protein (Cat# TP300249). The protein was produced from HEK293T cells transfected with RAB31 cDNA clone (Cat# RC200249) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200249
• Predicted MW: 21.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200249 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHS
  LAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAES
  IGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006859
• RefSeq Size: 4009
• RefSeq ORF: 585
• Synonyms: Rab22B
• Locus ID: 11031
• UniProt ID: Q13636
• Cytogenetics: 18p11.22
• Summary: Small GTP-binding proteins of the RAB family, such as RAB31, play essential roles in vesicle and granule targeting (Bao et al., 2002 [PubMed 11784320]). [supplied by OMIM, Jul 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis