TXNL4A (NM_006701) Human Mass Spec Standard

CAT#: PH300266

TXNL4A MS Standard C13 and N15-labeled recombinant protein (NP_006692)

Product Images

Coomassie blue staining of purified TXNL4A protein (Cat# TP300266). The protein was produced from HEK293T cells transfected with TXNL4A cDNA clone (Cat# RC200266) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200266
• Predicted MW: 16.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200266 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFN
  KMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKY
  RY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006692
• RefSeq Size: 1415
• RefSeq ORF: 426
• Synonyms: BMKS; DIB1; DIM1; SNRNP15; TXNL4; U5-15kD
• Locus ID: 10907
• UniProt ID: P83876
• Cytogenetics: 18q23
• Summary: The protein encoded by this gene is a member of the U5 small ribonucleoprotein particle (snRNP), and is involved in pre-mRNA splicing. This protein contains a thioredoxin-like fold and it is expected to interact with multiple proteins. Protein-protein interactions have been observed with the polyglutamine tract-binding protein 1 (PQBP1). Mutations in both the coding region and promoter region of this gene have been associated with Burn-McKeown syndrome, which is a rare disorder characterized by craniofacial dysmorphisms, cardiac defects, hearing loss, and bilateral choanal atresia. A pseudogene of this gene is found on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome