S100 beta (S100B) (NM_006272) Human Mass Spec Standard

CAT#: PH300277

S100B MS Standard C13 and N15-labeled recombinant protein (NP_006263)

Product Images

Coomassie blue staining of purified S100B protein (Cat# TP300277). The protein was produced from HEK293T cells transfected with S100B cDNA clone (Cat# RC200277) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200277
• Predicted MW: 10.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200277 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECD
  FQEFMAFVAMVTTACHEFFEHE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006263
• RefSeq Size: 1135
• RefSeq ORF: 276
• Synonyms: NEF; S100; S100-B; S100beta
• Locus ID: 6285
• UniProt ID: P04271, A0A0S2Z4C5
• Cytogenetics: 21q22.3
• Summary: 'The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. [provided by RefSeq, Jul 2008]'