CLPP (NM_006012) Human Mass Spec Standard

CAT#: PH300301

CLPP MS Standard C13 and N15-labeled recombinant protein (NP_006003)

Product Images

Coomassie blue staining of purified CLPP protein (Cat# TP300301). The protein was produced from HEK293T cells transfected with CLPP cDNA clone (Cat# RC200301) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200301
• Predicted MW: 30.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200301 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGE
  RAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYIL
  NPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYA
  KHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006003
• RefSeq Size: 1194
• RefSeq ORF: 831
• Synonyms: DFNB81; PRLTS3
• Locus ID: 8192
• UniProt ID: Q16740
• Cytogenetics: 19p13.3
• Summary: The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protease