STUB1 (NM_005861) Human Mass Spec Standard
CAT#: PH300310
STUB1 MS Standard C13 and N15-labeled recombinant protein (NP_005852)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200310 |
Predicted MW | 34.9 kDa |
Protein Sequence |
>RC200310 protein sequence
Red=Cloning site Green=Tags(s) MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCY LKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALR IAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMAD MDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL IPNLAMKEVIDAFISENGWVEDY SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005852 |
RefSeq Size | 1650 |
RefSeq ORF | 909 |
Synonyms | CHIP; HSPABP2; NY-CO-7; SCA48; SCAR16; SDCCAG7; UBOX1 |
Locus ID | 10273 |
UniProt ID | Q9UNE7 |
Cytogenetics | 16p13.3 |
Summary | This gene encodes a protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. The encoded protein binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other targets. Mutations in this gene cause spinocerebellar ataxia, autosomal recessive 16. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 2. [provided by RefSeq, Jun 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417031 | STUB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417031 | Transient overexpression lysate of STIP1 homology and U-box containing protein 1 (STUB1) |
USD 396.00 |
|
TP300310 | Recombinant protein of human STIP1 homology and U-box containing protein 1 (STUB1) |
USD 823.00 |
|
TP720096 | Recombinant protein of human STIP1 homology and U-box containing protein 1 (STUB1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review