STUB1 (NM_005861) Human Recombinant Protein

CAT#: TP300310

Recombinant protein of human STIP1 homology and U-box containing protein 1 (STUB1)

Product Images

Coomassie blue staining of purified STUB1 protein (Cat# TP300310). The protein was produced from HEK293T cells transfected with STUB1 cDNA clone (Cat# RC200310) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC200310
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALC
  YLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSA
  LRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKY
  MADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLT
  QEQLIPNLAMKEVIDAFISENGWVEDY
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
  Recombinant protein using RC200310 also available, TP300310M
• Tag: C-Myc/DDK
• Predicted MW: 34.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005852
• Locus ID: 10273
• UniProt ID: Q9UNE7
• Cytogenetics: 16p13.3
• Refseq Size: 1650
• Refseq ORF: 909
• Synonyms: CHIP; HSPABP2; NY-CO-7; SCA48; SCAR16; SDCCAG7; UBOX1
• Summary: This gene encodes a protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. The encoded protein binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other targets. Mutations in this gene cause spinocerebellar ataxia, autosomal recessive 16. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 2. [provided by RefSeq, Jun 2014]
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis