IDH3A (NM_005530) Human Mass Spec Standard

CAT#: PH300313

IDH3A MS Standard C13 and N15-labeled recombinant protein (NP_005521)

Product Images

Coomassie blue staining of purified IDH3A protein (Cat# TP300313). The protein was produced from HEK293T cells transfected with IDH3A cDNA clone (Cat# RC200313) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200313
• Predicted MW: 39.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200313 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWEERNVTA
  IQGPGGKWMIPSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDV
  NIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSDGL
  FLQKCREVAESCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGA
  NGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAK
  CSDFTEEICRRVKDLD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005521
• RefSeq Size: 2701
• RefSeq ORF: 1098
• Synonyms: H-IDH alpha; isocitrate dehydrogenase (NAD+) alpha chain; isocitrate dehydrogenase 3 (NAD+) a; isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; isocitric dehydrogenase; NAD(H)-specific isocitrate dehydrogenase alpha subunit; NAD+-specific ICDH
• Locus ID: 3419
• UniProt ID: P50213
• Cytogenetics: 15q25.1
• Summary: 'Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Citrate cycle (TCA cycle), Metabolic pathways