RHOC (NM_001042679) Human Mass Spec Standard

CAT#: PH300332

RHOC MS Standard C13 and N15-labeled recombinant protein (NP_001036144)

Product Images

Coomassie blue staining of purified RHOC protein (Cat# TP300332). The protein was produced from HEK293T cells transfected with RHOC cDNA clone (Cat# RC200332) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200332
• Predicted MW: 22 kDa
• Protein Sequence:
  Sequence Link

  >RC200332 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR
  PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR
  SEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001036144
• RefSeq Size: 1313
• RefSeq ORF: 579
• Synonyms: ARH9; ARHC; H9; RHOH9
• Locus ID: 389
• UniProt ID: P08134, A0A024R0C8
• Cytogenetics: 1p13.2
• Summary: 'This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome