RHOC (NM_175744) Human Mass Spec Standard
CAT#: PH317556
RHOC MS Standard C13 and N15-labeled recombinant protein (NP_786886)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217556 |
Predicted MW | 21.8 kDa |
Protein Sequence |
>RC217556 representing NM_175744
Red=Cloning site Green=Tags(s) MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR SEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_786886 |
RefSeq Size | 1116 |
RefSeq ORF | 579 |
Synonyms | ARH9; ARHC; H9; RHOH9 |
Locus ID | 389 |
UniProt ID | P08134, A0A024R0C8 |
Cytogenetics | 1p13.2 |
Summary | 'This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403579 | RHOC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421019 | RHOC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421020 | RHOC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425793 | RHOC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403579 | Transient overexpression lysate of ras homolog gene family, member C (RHOC), transcript variant 1 |
USD 396.00 |
|
LY421019 | Transient overexpression lysate of ras homolog gene family, member C (RHOC), transcript variant 2 |
USD 396.00 |
|
LY421020 | Transient overexpression lysate of ras homolog gene family, member C (RHOC), transcript variant 3 |
USD 396.00 |
|
LY425793 | Transient overexpression lysate of ras homolog gene family, member C (RHOC), transcript variant 2 |
USD 396.00 |
|
PH300332 | RHOC MS Standard C13 and N15-labeled recombinant protein (NP_001036144) |
USD 2,055.00 |
|
PH308751 | RHOC MS Standard C13 and N15-labeled recombinant protein (NP_001036143) |
USD 2,055.00 |
|
TP300332 | Recombinant protein of human ras homolog gene family, member C (RHOC), transcript variant 3 |
USD 823.00 |
|
TP308751 | Recombinant protein of human ras homolog gene family, member C (RHOC), transcript variant 2 |
USD 823.00 |
|
TP317556 | Recombinant protein of human ras homolog gene family, member C (RHOC), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review