CDK5 (NM_004935) Human Mass Spec Standard
CAT#: PH300342
CDK5 MS Standard C13 and N15-labeled recombinant protein (NP_004926)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200342 |
| Predicted MW | 33.3 kDa |
| Protein Sequence |
>RC200342 protein sequence
Red=Cloning site Green=Tags(s) MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL HSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGEL KLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDD QLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEA LQHPYFSDFCPP myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004926 |
| RefSeq Size | 1211 |
| RefSeq ORF | 876 |
| Synonyms | LIS7; PSSALRE |
| Locus ID | 1020 |
| UniProt ID | Q00535, A0A090N7W4 |
| Cytogenetics | 7q36.1 |
| Summary | 'This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]' |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Alzheimer's disease, Axon guidance |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401536 | CDK5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC431225 | CDK5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401536 | Transient overexpression lysate of cyclin-dependent kinase 5 (CDK5), transcript variant 1 |
USD 436.00 |
|
| LY431225 | Transient overexpression lysate of cyclin-dependent kinase 5 (CDK5), transcript variant 2 |
USD 436.00 |
|
| TP300342 | Recombinant protein of human cyclin-dependent kinase 5 (CDK5) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China