UXT (NM_004182) Human Mass Spec Standard

CAT#: PH300343

UXT MS Standard C13 and N15-labeled recombinant protein (NP_004173)

Product Images

Coomassie blue staining of purified UXT protein (Cat# TP300343). The protein was produced from HEK293T cells transfected with UXT cDNA clone (Cat# RC200343) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200343
• Predicted MW: 18.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200343 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQ
  VDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLE
  GLRELQGLQNFPEKPHH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004173
• RefSeq Size: 619
• RefSeq ORF: 471
• Synonyms: ART-27; STAP1
• Locus ID: 8409
• UniProt ID: Q9UBK9
• Cytogenetics: Xp11.23
• Summary: The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
• Protein Families: Druggable Genome