Germany
Japan
United Kingdom
China
Antibodies
View as table Download
UXT Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 13-169 of human UXT (NP_705582.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-UXT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UXT antibody: synthetic peptide directed towards the N terminal of human UXT. Synthetic peptide located within the following region: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL |
Rabbit Polyclonal Anti-UXT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UXT antibody: synthetic peptide directed towards the N terminal of human UXT. Synthetic peptide located within the following region: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL |
Rabbit Polyclonal Anti-UXT Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
UXT Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human UXT |
Active filters
Target Symbol
- UXT