UXT Rabbit Polyclonal Antibody

CAT#: TA342539

Rabbit Polyclonal Anti-UXT Antibody

Product Images

WB Suggested Anti-UXT Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UXT antibody: synthetic peptide directed towards the N terminal of human UXT. Synthetic peptide located within the following region: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: ubiquitously expressed prefoldin like chaperone
• Database Link:
  NP_004173
  Entrez Gene 8409 Human
  UniProt ID Q9UBK9
• Background: The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
• Synonyms: ART-27; STAP1
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome