UXT Rabbit Polyclonal Antibody

CAT#: TA339896

Rabbit Polyclonal Anti-UXT Antibody

Product Images

WB Suggested Anti-UXT Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UXT antibody: synthetic peptide directed towards the N terminal of human UXT. Synthetic peptide located within the following region: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: ubiquitously expressed prefoldin like chaperone
• Database Link:
  NP_705582
  Entrez Gene 8409 Human
  UniProt ID Q9UBK9
• Background: UXT is a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues.This gene encodes a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues. This gene is part of a gene cluster on chromosome Xp11.23. Alternative splicing results in 2 transcript variants encoding different isoforms.
• Synonyms: ART-27; STAP1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Goat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome