ROC1 (RBX1) (NM_014248) Human Mass Spec Standard

CAT#: PH300348

RBX1 MS Standard C13 and N15-labeled recombinant protein (NP_055063)

Product Images

Coomassie blue staining of purified RBX1 protein (Cat# TP300348). The protein was produced from HEK293T cells transfected with RBX1 cDNA clone (Cat# RC200348) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200348
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200348 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTV
  AWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055063
• RefSeq Size: 906
• RefSeq ORF: 324
• Synonyms: BA554C12.1; RNF75; ROC1
• Locus ID: 9978
• UniProt ID: P62877
• Cytogenetics: 22q13.2
• Summary: This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5. [provided by RefSeq, Sep 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Nucleotide excision repair, Oocyte meiosis, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway, Ubiquitin mediated proteolysis, Wnt signaling pathway