glutathione S transferase Omega 1 (GSTO1) (NM_004832) Human Mass Spec Standard
CAT#: PH300362
GSTO1 MS Standard C13 and N15-labeled recombinant protein (NP_004823)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200362 |
| Predicted MW | 27.6 kDa |
| Protein Sequence |
>RC200362 protein sequence
Red=Cloning site Green=Tags(s) MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFG LVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYA GLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDP TVSALLTSEKDWQGFLELYLQNSPEACDYGL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004823 |
| RefSeq Size | 1017 |
| RefSeq ORF | 723 |
| Synonyms | GSTO 1-1; GSTTLp28; HEL-S-21; P28; SPG-R |
| Locus ID | 9446 |
| UniProt ID | P78417, V9HWG9 |
| Cytogenetics | 10q25.1 |
| Summary | The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417720 | GSTO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC434052 | GSTO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY417720 | Transient overexpression lysate of glutathione S-transferase omega 1 (GSTO1) |
USD 436.00 |
|
| LY434052 | Transient overexpression lysate of glutathione S-transferase omega 1 (GSTO1), transcript variant 2 |
USD 436.00 |
|
| TP300362 | Recombinant protein of human glutathione S-transferase omega 1 (GSTO1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China