Neuraminidase (NEU1) (NM_000434) Human Mass Spec Standard

CAT#: PH300386

NEU1 MS Standard C13 and N15-labeled recombinant protein (NP_000425)

Product Images

Coomassie blue staining of purified NEU1 protein (Cat# TP300386). The protein was produced from HEK293T cells transfected with NEU1 cDNA clone (Cat# RC200386) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200386
• Predicted MW: 45.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200386 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQ
  IGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLG
  AVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREP
  RKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINAR
  NQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSF
  SNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000425
• RefSeq Size: 2088
• RefSeq ORF: 1245
• Synonyms: NANH; NEU; SIAL1
• Locus ID: 4758
• UniProt ID: Q99519, Q5JQI0
• Cytogenetics: 6p21.33
• Summary: 'The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Lysosome, Other glycan degradation, Sphingolipid metabolism