Fumarylacetoacetate hydrolase (FAH) (NM_000137) Human Mass Spec Standard

CAT#: PH300388

FAH MS Standard C13 and N15-labeled recombinant protein (NP_000128)

Product Images

Coomassie blue staining of purified FAH protein (Cat# TP300388). The protein was produced from HEK293T cells transfected with FAH cDNA clone (Cat# RC200388) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200388
• Predicted MW: 46.4 kDa
• Protein Sequence:
  Sequence Link

  >RC200388 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQPTLNSF
  MGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPATIGDYTDFYSSRQHATNVGIM
  FRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSKPPVYGACKLLDMELEMAFFVGPGN
  RLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYVPLGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQD
  PRPLPYLCHDEPYTFDINLSVNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGT
  ISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGYRIGFGQCAGKVLPALLPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000128
• RefSeq Size: 1810
• RefSeq ORF: 1257
• Locus ID: 2184
• UniProt ID: P16930, A0A384P5L6
• Cytogenetics: 15q25.1
• Summary: 'This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Tyrosine metabolism