OXSR1 (NM_005109) Human Mass Spec Standard

CAT#: PH300396

OXSR1 MS Standard C13 and N15-labeled recombinant protein (NP_005100)

Product Images

Coomassie blue staining of purified OXSR1 protein (Cat# TP300396). The protein was produced from HEK293T cells transfected with OXSR1 cDNA clone (Cat# RC200396) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200396
• Predicted MW: 58 kDa
• Protein Sequence:
  Sequence Link

  >RC200396 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQC
  HHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKN
  GQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADI
  WSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRP
  TAAELLRHKFFQKAKNKEFLQEKTLQRAPTISERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEG
  KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQA
  LSSGSGSQETKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIV
  EEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005100
• RefSeq Size: 4525
• RefSeq ORF: 1581
• Synonyms: OSR1
• Locus ID: 9943
• UniProt ID: O95747
• Cytogenetics: 3p22.2
• Summary: The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase