gamma Tubulin (TUBG1) (NM_001070) Human Mass Spec Standard

CAT#: PH300408

TUBG1 MS Standard C13 and N15-labeled recombinant protein (NP_001061)

Product Images

Coomassie blue staining of purified TUBG1 protein (Cat# TP300408). The protein was produced from HEK293T cells transfected with TUBG1 cDNA clone (Cat# RC200408) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200408
• Predicted MW: 51.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200408 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE
  PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS
  IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL
  NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ
  SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP
  WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE
  MDTSREIVQQLIDEYHAATRPDYISWGTQEQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001061
• RefSeq Size: 1968
• RefSeq ORF: 1353
• Synonyms: CDCBM4; GCP-1; TUBG; TUBGCP1
• Locus ID: 7283
• UniProt ID: P23258
• Cytogenetics: 17q21.2
• Summary: 'This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7. [provided by RefSeq, Jan 2009]'
• Protein Families: Druggable Genome