AK6 (NM_016283) Human Mass Spec Standard

CAT#: PH300412

TAF9 MS Standard C13 and N15-labeled recombinant protein (NP_057367)

Product Images

Coomassie blue staining of purified AK6 protein (Cat# TP300412). The protein was produced from HEK293T cells transfected with AK6 cDNA clone (Cat# RC200412) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200412
• Predicted MW: 20.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200412 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMR
  EGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEI
  VHQLPSNKPEELENNVDQILKWIEQWIKDHNS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057367
• RefSeq Size: 962
• RefSeq ORF: 516
• Synonyms: AD-004; CGI-137; CINAP; CIP; hCINAP
• Locus ID: 102157402
• UniProt ID: Q9Y3D8
• Cytogenetics: 5q13.2
• Summary: This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]