AK6 (NM_016283) Human Recombinant Protein

CAT#: TP300412

Recombinant protein of human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2

Product Images

Coomassie blue staining of purified AK6 protein (Cat# TP300412). The protein was produced from HEK293T cells transfected with AK6 cDNA clone (Cat# RC200412) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200412 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMR
  EGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEI
  VHQLPSNKPEELENNVDQILKWIEQWIKDHNS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057367
• Locus ID: 102157402
• UniProt ID: Q9Y3D8
• Cytogenetics: 5q13.2
• Refseq Size: 962
• Refseq ORF: 516
• Synonyms: AD-004; CGI-137; CINAP; CIP; hCINAP
• Summary: This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]