Sorbitol Dehydrogenase (SORD) (NM_003104) Human Mass Spec Standard

CAT#: PH300415

SORD MS Standard C13 and N15-labeled recombinant protein (NP_003095)

Product Images

Coomassie blue staining of purified SORD protein (Cat# TP300415). The protein was produced from HEK293T cells transfected with SORD cDNA clone (Cat# RC200415) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200415
• Predicted MW: 38.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200415 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGH
  EASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFC
  YKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRL
  SKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMT
  TVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKC
  DPSDQNP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003095
• RefSeq Size: 2813
• RefSeq ORF: 1071
• Synonyms: HEL-S-95n; RDH; SDH; SORD1; XDH
• Locus ID: 6652
• UniProt ID: Q00796
• Cytogenetics: 15q21.1
• Summary: 'Sorbitol dehydrogenase (SORD; EC 1.1.1.14) catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase (ALDR1; MIM 103880), makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications (summarized by Carr and Markham, 1995 [PubMed 8535074]). The first reaction of the pathway (also called the polyol pathway) is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NAD(+) cofactor.[supplied by OMIM, Jul 2010]'
• Protein Families: Druggable Genome
• Protein Pathways: Fructose and mannose metabolism, Metabolic pathways