GALK1 (NM_000154) Human Mass Spec Standard

CAT#: PH300476

GALK1 MS Standard C13 and N15-labeled recombinant protein (NP_000145)

Product Images

Coomassie blue staining of purified GALK1 protein (Cat# TP300476). The protein was produced from HEK293T cells transfected with GALK1 cDNA clone (Cat# RC200476) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200476
• Predicted MW: 42.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200476 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKD
  GLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLS
  SSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSL
  VPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARH
  VVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGG
  CTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000145
• RefSeq Size: 1361
• RefSeq ORF: 1176
• Synonyms: GALK; GK1; HEL-S-19
• Locus ID: 2584
• UniProt ID: P51570, V9HWE7
• Cytogenetics: 17q25.1
• Summary: 'Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways