Claudin 4 (CLDN4) (NM_001305) Human Mass Spec Standard

CAT#: PH300490

CLDN4 MS Standard C13 and N15-labeled recombinant protein (NP_001296)

Product Images

Coomassie blue staining of purified CLDN4 protein (Cat# TP300490). The protein was produced from HEK293T cells transfected with CLDN4 cDNA clone (Cat# RC200490) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200490
• Predicted MW: 22.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200490 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSL
  LALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTA
  HNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001296
• RefSeq Size: 1859
• RefSeq ORF: 627
• Synonyms: CPE-R; CPER; CPETR; CPETR1; hCPE-R; WBSCR8
• Locus ID: 1364
• UniProt ID: O14493, Q75L80
• Cytogenetics: 7q11.23
• Summary: 'The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq, Sep 2013]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction