UROD (NM_000374) Human Mass Spec Standard

CAT#: PH300529

UROD MS Standard C13 and N15-labeled recombinant protein (NP_000365)

Product Images

Coomassie blue staining of purified UROD protein (Cat# TP300529). The protein was produced from HEK293T cells transfected with UROD cDNA clone (Cat# RC200529) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200529
• Predicted MW: 40.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200529 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTL
  QPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITL
  TRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAG
  AQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVV
  GLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHV
  GAFVDAVHKHSRLLRQN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000365
• RefSeq Size: 1408
• RefSeq ORF: 1101
• Synonyms: PCT; UPD
• Locus ID: 7389
• UniProt ID: P06132
• Cytogenetics: 1p34.1
• Summary: 'This gene encodes an enzyme in the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.[provided by RefSeq, Aug 2010]'
• Protein Families: Druggable Genome
• Protein Pathways: Porphyrin and chlorophyll metabolism