UROD (NM_000374) Human Recombinant Protein
CAT#: TP300529
Recombinant protein of human uroporphyrinogen decarboxylase (UROD)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200529 protein sequence
Red=Cloning site Green=Tags(s) MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTL QPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITL TRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAG AQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVV GLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHV GAFVDAVHKHSRLLRQN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000365 |
Locus ID | 7389 |
UniProt ID | P06132 |
Cytogenetics | 1p34.1 |
Refseq Size | 1408 |
Refseq ORF | 1101 |
Synonyms | PCT; UPD |
Summary | This gene encodes an enzyme in the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.[provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424758 | UROD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424758 | Transient overexpression lysate of uroporphyrinogen decarboxylase (UROD) |
USD 325.00 |
|
PH300529 | UROD MS Standard C13 and N15-labeled recombinant protein (NP_000365) |
USD 2,055.00 |
|
TP720245 | Recombinant protein of human uroporphyrinogen decarboxylase (UROD) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review