ESD (NM_001984) Human Mass Spec Standard

CAT#: PH300533

ESD MS Standard C13 and N15-labeled recombinant protein (NP_001975)

Product Images

Coomassie blue staining of purified ESD protein (Cat# TP300533). The protein was produced from HEK293T cells transfected with ESD cDNA clone (Cat# RC200533) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200533
• Predicted MW: 31.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200533 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQS
  ASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDP
  QRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKS
  YPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEDYDHSYYFIATFITDHIRHHAKYL
  NA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001975
• RefSeq Size: 1208
• RefSeq ORF: 846
• Synonyms: FGH
• Locus ID: 2098
• UniProt ID: P10768, A0A140VJJ2
• Cytogenetics: 13q14.2
• Summary: 'This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. [provided by RefSeq, Feb 2009]'