ESD (NM_001984) Human Mass Spec Standard
CAT#: PH300533
ESD MS Standard C13 and N15-labeled recombinant protein (NP_001975)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200533 |
Predicted MW | 31.5 kDa |
Protein Sequence |
>RC200533 protein sequence
Red=Cloning site Green=Tags(s) MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQS ASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDP QRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKS YPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEDYDHSYYFIATFITDHIRHHAKYL NA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001975 |
RefSeq Size | 1208 |
RefSeq ORF | 846 |
Synonyms | FGH |
Locus ID | 2098 |
UniProt ID | P10768, A0A140VJJ2 |
Cytogenetics | 13q14.2 |
Summary | 'This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. [provided by RefSeq, Feb 2009]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419606 | ESD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419606 | Transient overexpression lysate of esterase D/formylglutathione hydrolase (ESD) |
USD 396.00 |
|
TP300533 | Recombinant protein of human esterase D/formylglutathione hydrolase (ESD) |
USD 823.00 |
|
TP720113 | Recombinant protein of human esterase D/formylglutathione hydrolase (ESD) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review