NDUFA7 (NM_005001) Human Mass Spec Standard

CAT#: PH300534

NDUFA7 MS Standard C13 and N15-labeled recombinant protein (NP_004992)

Product Images

Coomassie blue staining of purified NDUFA7 protein (Cat# TP300534). The protein was produced from HEK293T cells transfected with NDUFA7 cDNA clone (Cat# RC200534) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200534
• Predicted MW: 12.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200534 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIM
  SSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004992
• RefSeq Size: 585
• RefSeq ORF: 339
• Synonyms: B14.5a; CI-B14.5a
• Locus ID: 4701
• UniProt ID: O95182
• Cytogenetics: 19p13.2
• Summary: This gene encodes a subunit of NADH:ubiquinone oxidoreductase (complex I), which is a multiprotein complex located in the inner mitochondrial membrane. Complex I functions in the transfer of electrons from NADH to the respiratory chain. [provided by RefSeq, Mar 2011]
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease