NDUFA7 (NM_005001) Human Recombinant Protein

CAT#: TP300534

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa (NDUFA7)


  View other "NDUFA7" proteins (3)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


NDUFA7 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
    • 100 ul

USD 379.00

Other products for "NDUFA7"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC200534 protein sequence
Red=Cloning site Green=Tags(s)

MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIM
SSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.4 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_004992
Locus ID 4701
UniProt ID O95182
Cytogenetics 19p13.2
Refseq Size 585
Refseq ORF 339
Synonyms B14.5a; CI-B14.5a
Summary This gene encodes a subunit of NADH:ubiquinone oxidoreductase (complex I), which is a multiprotein complex located in the inner mitochondrial membrane. Complex I functions in the transfer of electrons from NADH to the respiratory chain. [provided by RefSeq, Mar 2011]
Protein Pathways Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.