NDUFA7 (NM_005001) Human Recombinant Protein

CAT#: TP300534

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa (NDUFA7)

Product Images

Coomassie blue staining of purified NDUFA7 protein (Cat# TP300534). The protein was produced from HEK293T cells transfected with NDUFA7 cDNA clone (Cat# RC200534) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200534 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIM
  SSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004992
• Locus ID: 4701
• UniProt ID: O95182
• Cytogenetics: 19p13.2
• Refseq Size: 585
• Refseq ORF: 339
• Synonyms: B14.5a; CI-B14.5a
• Summary: This gene encodes a subunit of NADH:ubiquinone oxidoreductase (complex I), which is a multiprotein complex located in the inner mitochondrial membrane. Complex I functions in the transfer of electrons from NADH to the respiratory chain. [provided by RefSeq, Mar 2011]
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease