RER1 (NM_007033) Human Mass Spec Standard

CAT#: PH300545

RER1 MS Standard C13 and N15-labeled recombinant protein (NP_008964)

Product Images

Coomassie blue staining of purified RER1 protein (Cat# TP300545). The protein was produced from HEK293T cells transfected with RER1 cDNA clone (Cat# RC200545) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200545
• Predicted MW: 23 kDa
• Protein Sequence:
  Sequence Link

  >RC200545 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYA
  LGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMVCTFFDA
  FNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYRGKEDAGKAFAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008964
• RefSeq Size: 3118
• RefSeq ORF: 462
• Synonyms: RP4-740C4.2
• Locus ID: 11079
• UniProt ID: O15258, Q5T094
• Cytogenetics: 1p36.32
• Summary: The protein encoded by this gene is a multi-pass membrane protein that is localized to the golgi apparatus. It is involved in the retention of endoplasmic reticulum (ER) membrane proteins in the ER and retrieval of ER membrane proteins from the early Golgi compartment to facilitate gamma-secretase complex assembly. [provided by RefSeq, Oct 2009]
• Protein Families: Transmembrane