MSK1 (RPS6KA5) (NM_182398) Human Mass Spec Standard
CAT#: PH300549
RPS6KA5 MS Standard C13 and N15-labeled recombinant protein (NP_872198)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200549 |
Predicted MW | 61.8 kDa |
Protein Sequence |
>RC200549 protein sequence
Red=Cloning site Green=Tags(s) MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKIS GHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELF THLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETERA YSFCGTIEYMAPDIVRGGDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQ EMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAE EFTEMDPTYSPAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHD QLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPEV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_872198 |
RefSeq Size | 2343 |
RefSeq ORF | 1647 |
Synonyms | MSK1; MSPK1; RLPK |
Locus ID | 9252 |
UniProt ID | O75582 |
Cytogenetics | 14q32.11 |
Protein Families | Druggable Genome, Protein Kinase, Transcription Factors |
Protein Pathways | Bladder cancer, MAPK signaling pathway, Neurotrophin signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403633 | RPS6KA5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417768 | RPS6KA5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC429221 | RPS6KA5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY403633 | Transient overexpression lysate of ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 2 |
USD 396.00 |
|
LY417768 | Transient overexpression lysate of ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 1 |
USD 605.00 |
|
LY429221 | Transient overexpression lysate of ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 1 |
USD 605.00 |
|
PH320636 | RPS6KA5 MS Standard C13 and N15-labeled recombinant protein (NP_004746) |
USD 2,055.00 |
|
TP300549 | Recombinant protein of human ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 2 |
USD 867.00 |
|
TP320636 | Recombinant protein of human ribosomal protein S6 kinase, 90kDa, polypeptide 5 (RPS6KA5), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review