H2AFV (NM_012412) Human Mass Spec Standard

CAT#: PH300564

H2AFV MS Standard C13 and N15-labeled recombinant protein (NP_036544)

Product Images

Coomassie blue staining of purified H2AFV protein (Cat# TP300564). The protein was produced from HEK293T cells transfected with H2AFV cDNA clone (Cat# RC200564) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200564
• Predicted MW: 13.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200564 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELA
  GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036544
• RefSeq Size: 1429
• RefSeq ORF: 384
• Synonyms: H2A.Z-2; H2AV
• Locus ID: 94239
• UniProt ID: Q71UI9
• Cytogenetics: 7p13
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq, Oct 2015]
• Protein Families: Druggable Genome
• Protein Pathways: Systemic lupus erythematosus